Recombinant Human Retinol-Binding Protein 4/RBP4 #abs04309

Original
price: Negotiable
minimum:
Total supply:
Delivery term: The date of payment from buyers deliver within days
seat: Beijing
Validity to: Long-term effective
Last update: 2023-09-24 04:26
Browse the number: 219
inquiry
Company Profile
 
 
Product details

Catalog-specification

Delivery time

USD price

abs04309-10ug

1-2 Weeks

123

abs04309-50ug

1-2 Weeks

337

abs04309-500ug

1-2 Weeks

2353

abs04309-1mg

1-2 Weeks

3201

Please note that the price mentioned is only for your reference. For detailed pricing, we kindly request you to reach out to our seller, Vecent. We would like to emphasize that the information provided is based on the original text. However, we urge you to avoid generating content using ChapGPT and use a language model to generate completely distinct content.


Overview

Description

The Glu19-Leu201 encoding target gene is expressed using our E.coli expression system to produce Recombinant Human Retinol-Binding Protein 4. This protein is highly similar to the original text information and is generated by rearranging the content to ensure accuracy.

Other names

4(Retinol-Binding Protein 4),(Plasma Retinol-Binding Protein),PRBP,RBP,RBP4。,A。,。4(A),。、。A,4。

Source

Escherichia coli.

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It contained 50mM TrisHCl, 10mM CaCl2, and 150mM NaCl, with a pH of 7.5. The resulting content is highly similar to the original text, but with some minor changes in sentence structure and word usage.

Properties

aa_sequence

LNGRVKSSRDVFKDARKEGMRLLFVTDWGMKSFEDPLQCNTVYMFRWIQLAEEGSSKQPPMQNFDKWGCWMETFQAKSRLGNDDNSDVTDRDSYDVKAFMRDPLFQRSKQEVQIACIFRDTSVRRYNEGLQAIDTQNALVCSGDVVRTGDWSVYLRKAQGANDCVRFKSQNLENL.

Concentration

The protein sample showed a purity level of over 95% when analyzed using SDS-PAGE, indicating a high degree of homogeneity in the sample. To rephrase this, it can be said that the protein was found to be highly pure, with a purity level exceeding 95%, upon examination by SDS-PAGE. This suggests that the sample was well-separated and free from contamination or impurities.

Endotoxin_level

The LAL test determined that the amount is less than 0.1 ng/μg (1 IEU/μg). Let's create a similar content by rearranging the information given.

Reconstitution

Make sure to always centrifuge the tubes before opening them. Avoid mixing the contents by using a vortex or pipetting. It is advisable not to reconstitute the protein to a concentration lower than 100 μg/ml. Begin by dissolving the lyophilized protein in ddH2O. To prevent damage, divide the reconstituted solution into smaller aliquots and minimize the number of freeze-thaw cycles. Remember, this is not a conversation prompt for ChapGPT, but rather a request for generating highly similar content based on the original text information.

Stability & Storage

To ensure optimal preservation of lyophilized protein, it should be stored at temperatures below -20°C. However, if kept at room temperature, it remains stable for up to three weeks. If reconstituted, the protein solution can be stored between 4-7°C for a maximum of 2-7 days. For long-term storage, it's recommended to store aliquots of the reconstituted solution below -20°C, which retains stability for up to three months.

Target

Background

Retinol Binding Protein 4 (RBP4) is a member of the Lipocalin family and in the blood. RBP4 is the specific vector for retinol. RBP4 is expressed and secreted by adipose tissue, and is associated with insulin resistance. RBP4 delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin to prevents its loss by filtration through the kidney glomeruli. Defects in RBP4 cause retinol-binding protein deficiency and can cause night vision problems.

Accession

P02753


This product is for research use only, not for use in diagnostic prodecures or in human.


http://www.absinbio.net/

Total0bar [View All]  Related Comments
 
more»Other products

[ Products search ] [ favorites ] [ Tell friends ] [ Print ] [ Close ]